PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 181aa    MW: 20545.4 Da    PI: 5.8475
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015613.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260104.11.2e-326102197
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                  aCaaCk++rrkC++ C la yfpa++  +f n+++ FG+sn+ k+l+++++++r++a++++++e++++ ++P  G++gv + l++q++ +++el+++
  Pbr015613.1   6 ACAACKYQRRKCTQTCELASYFPASRFVEFVNAQHTFGMSNIEKILATVEPDQRPAAAETILFEGNIWRNNPSVGCLGVTRFLREQVDFHEKELEMT 102
                  7********************************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.2235106IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-296102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MANSKACAAC KYQRRKCTQT CELASYFPAS RFVEFVNAQH TFGMSNIEKI LATVEPDQRP  60
AAAETILFEG NIWRNNPSVG CLGVTRFLRE QVDFHEKELE MTNLYLAFYR ELKQQLDSLK  120
IQSAREAPVV PDQFPRITAE MKKYEEGYIY MSSLEDAQEK AFVIGLMQPA SFSGPGESRY  180
*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352702.12e-90PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A067E2B92e-41A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
TrEMBLM5VSQ03e-41M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-30LOB domain-containing protein 22